Hangzhou Go Top Peptide Biotech Co., Ltd. was founded in 2014, is a national high-tech enterprise specializing in R&D and production of peptides and related derivatives. It is also a governing unit of Polypeptide Branch of China Biochemical and Pharmaceutical Industry Association. At present, the company has a peptide research and development center in Hangzhou, covering an area of more than 4,000 square meters, and two commercial peptide factories in Shangyu and Anji, Zhejiang, with several complete peptide production lines, several sets of large-scale peptide synthesis equipment, imported HPLC analysis and preparation equipment, and equipped with a GMP standard clean laboratory. The company has passed the ISO9001:2015 quality management system certification.

Hangzhou Go Top Peptide Biotech Co., Ltd. blev grundlagt i 2014, er en national højteknologisk virksomhed med speciale i R&D og produktion af peptider og relaterede derivater. Det er også en styrende enhed i Polypeptide Branch of China Biochemical and Pharmaceutical Industry Association. På nuværende tidspunkt har virksomheden et peptidforsknings- og udviklingscenter i Hangzhou, der dækker et areal på mere end 4.000 kvadratmeter, og to kommercielle peptidfabrikker i Shangyu og Anji, Zhejiang, med flere komplette peptidproduktionslinjer, flere sæt storstilet peptidsynteseudstyr, importeret HPLC-analyse- og forberedelsesudstyr og rent udstyret med et GMP-standardudstyr. Virksomheden har bestået ISO9001:2015 kvalitetsstyringssystemcertificering.